Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000421-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000421-M01, RRID:AB_509152
- Product name
- ARVCF monoclonal antibody (M01), clone 5D2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ARVCF.
- Antigen sequence
LSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALG
PDGYSTVDRRERRPRGASSAGEASEKEPLKLDPSR
KAPPPGPSRPAVRLVDAVGDAKPQPVDSWV- Isotype
- IgG
- Antibody clone number
- 5D2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Xenopus Kazrin interacts with ARVCF-catenin, spectrin and p190B RhoGAP, and modulates RhoA activity and epithelial integrity.
Cho K, Vaught TG, Ji H, Gu D, Papasakelariou-Yared C, Horstmann N, Jennings JM, Lee M, Sevilla LM, Kloc M, Reynolds AB, Watt FM, Brennan RG, Kowalczyk AP, McCrea PD
Journal of cell science 2010 Dec 1;123(Pt 23):4128-44
Journal of cell science 2010 Dec 1;123(Pt 23):4128-44
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ARVCF monoclonal antibody (M01), clone 5D2 Western Blot analysis of ARVCF expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ARVCF on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol