Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA043935 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-CARS2
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LASLYEEDFKQDMAALKVLPPTVYLRVTENIPQII
SFIEGIIARGNAYSTAKGNVYFDLKSRGDKYGKLV
G- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Supersulphides provide airway protection in viral and chronic lung diseases
Matsunaga T, Sano H, Takita K, Morita M, Yamanaka S, Ichikawa T, Numakura T, Ida T, Jung M, Ogata S, Yoon S, Fujino N, Kyogoku Y, Sasaki Y, Koarai A, Tamada T, Toyama A, Nakabayashi T, Kageyama L, Kyuwa S, Inaba K, Watanabe S, Nagy P, Sawa T, Oshiumi H, Ichinose M, Yamada M, Sugiura H, Wei F, Motohashi H, Akaike T
Nature Communications 2023;14(1)
Nature Communications 2023;14(1)
No comments: Submit comment
No validations: Submit validation data