H00084295-M01

PHF6 antibody from Abnova Corporation
BFLS, BORJ, CENP-31, KIAA1823, MGC14797

Antibody data

Product number
H00084295-M01
Provider
Abnova Corporation
Product name
PHF6 monoclonal antibody (M01), clone 8F24
Provider product page
Abnova Corporation - H00084295-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PHF6.
Antigen sequence
MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISE
NQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDV
QKEIKRGTKLMCSLCHCPGATIGCDVKTC
Isotype
IgG
Antibody clone number
8F24
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -