HPA001023

PHF6 antibody from Atlas Antibodies
BFLS, BORJ, CENP-31, KIAA1823, MGC14797
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001023
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001023, RRID:AB_1079606
Product name
Anti-PHF6
Provider product page
Atlas Antibodies - HPA001023
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISE
NQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDV
QKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYHY
HCALHDK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -