HPA001023

PHF6 antibody from Atlas Antibodies
BFLS, BORJ, CENP-31, KIAA1823, MGC14797
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001023
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001023, RRID:AB_611698
Product name
Anti-PHF6
Provider product page
Atlas Antibodies - HPA001023
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISE
NQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDV
QKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYHY
HCALHDK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -