HPA001023

PHF6 antibody from Sigma-Aldrich
BFLS, BORJ, CENP-31, KIAA1823, MGC14797
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001023
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001023, RRID:AB_1079606
Product name
Anti-PHF6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001023
Antibody type
Polyclonal
Antigen
PHD finger protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISE
NQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDV
QKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYHY
HCALHDK
Storage
-20C
Provider Type Product Number
- No reagents -