Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001345-B01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001345-B01P, RRID:AB_10755954
- Product name
- COX6C purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human COX6C protein.
- Antigen sequence
MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAA
LYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGI
FQSVK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of COX6C expression in transfected 293T cell line (H00001345-T01) by COX6C MaxPab polyclonal antibody.Lane 1: COX6C transfected lysate(8.8 KDa).Lane 2: Non-transfected lysate.