Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005071-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005071-M01, RRID:AB_464345
- Product name
- PARK2 monoclonal antibody (M01), clone 1H4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PARK2.
- Antigen sequence
PCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHH
FRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCG
AGLLPEPDQRKVTCEGGNGLGCGYGQRRTK- Isotype
- IgG
- Antibody clone number
- 1H4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Regional and cellular localisation of Parkin co-regulated gene in developing and adult mouse brain.
Brody KM, Taylor JM, Wilson GR, Delatycki MB, Lockhart PJ
Brain research 2008 Mar 27;1201:177-86
Brain research 2008 Mar 27;1201:177-86
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PARK2 monoclonal antibody (M01), clone 1H4. Western Blot analysis of PARK2 expression in PC-12.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PARK2 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PARK2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol