HPA020464

PWWP3B antibody from Atlas Antibodies
FLJ33516, MUM1L1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020464
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020464, RRID:AB_1854209
Product name
Anti-MUM1L1
Provider product page
Atlas Antibodies - HPA020464
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AVMSVHSAVKEESACVKDEKFAPPLSPLSSDMLIM
PKALKEESEDTCLETLAVPSECSAFSENIEDPGEG
PSNPCLDTSQNQPSMESEMGAAACPGSCSRECEVS
FSASNPVWDYSHLMSSERNFQRLDFEELEEEGQAS
DKSLLPSRI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -