HPA000168

PWWP3B antibody from Atlas Antibodies
FLJ33516, MUM1L1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000168
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000168, RRID:AB_1079431
Product name
Anti-MUM1L1
Provider product page
Atlas Antibodies - HPA000168
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KVALGILNERTNLSQASTSDEEEITMLSQNVPQKQ
SDSPPHKKYRKDEGDLPGCLEERENSACLLASSES
DDSLYDDKSQAPTMVDTIPSEVETKSLQNSSWCET
FPSLSE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -