HPA061282

ALYREF antibody from Atlas Antibodies
ALY, ALY/REF, BEF, REF, THOC4

Antibody data

Product number
HPA061282
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA061282, RRID:AB_2684464
Product name
Anti-ALYREF
Provider product page
Atlas Antibodies - HPA061282
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGV
ET
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -