Antibody data

Product number
H00010189-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010189-M03, RRID:AB_10963661
Product name
ALYREF monoclonal antibody (M03), clone 2G8
Provider product page
Abnova Corporation - H00010189-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ALYREF.
Antigen sequence
GKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYD
RSGRSLGTADVHFERKADALKAMKQYNGVPLDGRP
MNIQLVTSQIDAQRRPAQ
Isotype
IgG
Antibody clone number
2G8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -