PAB21240

ALYREF antibody from Abnova Corporation
ALY, ALY/REF, BEF, REF, THOC4

Antibody data

Product number
PAB21240
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21240, RRID:AB_10965715
Product name
ALYREF polyclonal antibody
Provider product page
Abnova Corporation - PAB21240
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ALYREF.
Antigen sequence
EFGTLKKAAVHYDRSGRSLGTADVHFERKADALKA
MKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNR
GGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGR
NSKQQLSAEELDAQLDAYNARMD
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -