HPA019799

ALYREF antibody from Sigma-Aldrich
ALY, ALY/REF, BEF, REF, THOC4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019799
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019799, RRID:AB_1844788
Product name
Anti-THOC4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019799
Antibody type
Polyclonal
Antigen
THO complex subunit 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EFGTLKKAAVHYDRSGRSLGTADVHFERKADALKA
MKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNR
GGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGR
NSKQQLSAEELDAQLDAYNARMD
Storage
-20C
Provider Type Product Number
- No reagents -