Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182388 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-E2F Transcription Factor 2 (E2F2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-E2F2 antibody: synthetic peptide directed towards the middle region of human E2F2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine
- Host
- Rabbit
- Antigen sequence
QWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALD
QLIQS CSLSFKHLTE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Alpha-synuclein degradation by serine protease neurosin: implication for pathogenesis of synucleinopathies.
Differential binding of transcription factor E2F-2 to the endothelin-converting enzyme-1b promoter affects blood pressure regulation.
Iwata A, Maruyama M, Akagi T, Hashikawa T, Kanazawa I, Tsuji S, Nukina N
Human molecular genetics 2003 Oct 15;12(20):2625-35
Human molecular genetics 2003 Oct 15;12(20):2625-35
Differential binding of transcription factor E2F-2 to the endothelin-converting enzyme-1b promoter affects blood pressure regulation.
Funke-Kaiser H, Reichenberger F, Köpke K, Herrmann SM, Pfeifer J, Orzechowski HD, Zidek W, Paul M, Brand E
Human molecular genetics 2003 Feb 15;12(4):423-33
Human molecular genetics 2003 Feb 15;12(4):423-33
No comments: Submit comment
No validations: Submit validation data