Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1107973 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-KIN, Antigenic Determinant of RecA Protein Homolog (Mouse) (KIN) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KIN antibody: synthetic peptide directed towards the middle region of human KIN
- Description
- Purified using Protein A affinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
EEKTAKFIEEQVRRGLEGKEQEVPTFTELSRENDE
EKVTFNLSKGACSSS- Epitope
- Middle Region
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Jurkat; WB Suggested Anti-KIN Antibody Titration: 2.5ug/ml. Positive Control: Jurkat cell lysate; KIN antibody - middle region (AP42102PU-N) in Human Jurkat cells using Western Blot