AV32295

KIN antibody from Sigma-Aldrich
KIN17, Rts2
No application information provided.

Antibody data

Product number
AV32295
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV32295, RRID:AB_1852463
Product name
Anti-KIN antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV32295
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human KIN with an internal ID of P23961
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
GLEGKEQEVPTFTELSRENDEEKVTFNLSKGACSS
SGATSSKSSTLGPSA
Storage
-20C
Provider Type Product Number
- No reagents -