HPA003734

RRAGA antibody from Atlas Antibodies
FIP-1, RAGA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003734
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003734, RRID:AB_1079851
Product name
Anti-RRAGA
Provider product page
Atlas Antibodies - HPA003734
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQ
RDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEA
ILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREED
LRRLSRPLECSCF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -