H00255027-B01P

MPV17L antibody from Abnova Corporation
FLJ39599, MLPH1, MLPH2, MPV17L1

Antibody data

Product number
H00255027-B01P
Provider
Abnova Corporation
Product name
MPV17L purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00255027-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MPV17L protein.
Antigen sequence
MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQ
QRLQGREANWRQTRRVATLVVTFHANFNYVWLRLL
ERALPGRAPHALLAKLLCDQVVGAPIAVSAFYVEW
TDVLALCTADQLQPCSCSMENSLRWSLWFSLGHLH
LFFPAEW
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.