Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA062520 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-DCSTAMP
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LGPCGWKYENIYITRQFVQFDERERHQQRPCVLPL
NKEERRKYVIIPTFWPTPKERK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references Osteoclast profile of medication-related osteonecrosis of the jaw secondary to bisphosphonate therapy: a comparison with osteoradionecrosis and osteomyelitis
Gross C, Weber M, Creutzburg K, Möbius P, Preidl R, Amann K, Wehrhan F
Journal of Translational Medicine 2017;15(1)
Journal of Translational Medicine 2017;15(1)
No comments: Submit comment
No validations: Submit validation data