HPA027533

PCDH19 antibody from Sigma-Aldrich
EFMR, EIEE9, KIAA1313
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027533
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027533, RRID:AB_10602043
Product name
Anti-PCDH19 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027533
Antibody type
Polyclonal
Antigen
protocadherin 19 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQ
NTRNTSANHIYHHSFNSQGPQQPDLIINGVPLPET
ENYSFDSNYVNSRAHLIKSSSTFKDLEGNSLKDSG
HEESDQTDSEHDVQRSLYCDTAVNDVLNTSVTSMG
SQMPD
Storage
-20C
Provider Type Product Number
- No reagents -