Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310177 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Formiminotransferase Cyclodeaminase (FTCD) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FTCD antibody: synthetic peptide directed towards the N terminal of human FTCD
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTN
RTVYT FVGPPECVVE- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The molecular basis of glutamate formiminotransferase deficiency.
Bilateral cochlear implantation in children.
Hilton JF, Christensen KE, Watkins D, Raby BA, Renaud Y, de la Luna S, Estivill X, MacKenzie RE, Hudson TJ, Rosenblatt DS
Human mutation 2003 Jul;22(1):67-73
Human mutation 2003 Jul;22(1):67-73
Bilateral cochlear implantation in children.
Vermeire K, Brokx JP, Van de Heyning PH, Cochet E, Carpentier H
International journal of pediatric otorhinolaryngology 2003 Jan;67(1):67-70
International journal of pediatric otorhinolaryngology 2003 Jan;67(1):67-70
No comments: Submit comment
No validations: Submit validation data