HPA020073

FTCD antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020073
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020073, RRID:AB_1849005
Product name
Anti-FTCD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020073
Antibody type
Polyclonal
Antigen
Formimidoyltransferase-cyclodeaminase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MRLPKNIPEEKDRRTAALQEGLRRAVSVPLTLAET
VASLWLALQELARCGNLACRSDLQVAAKALEMGVF
GAYFNVLINLRDITDEAFKDQIHHRV
Storage
-20C
Provider Type Product Number
- No reagents -