HPA064099

TM9SF4 antibody from Atlas Antibodies
dJ836N17.2, KIAA0255
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA064099
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA064099, RRID:AB_2685190
Product name
Anti-TM9SF4
Provider product page
Atlas Antibodies - HPA064099
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDV
QFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEE
DQEHTYRVVRFE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -