HPA026306

RPA2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026306
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026306, RRID:AB_10598913
Product name
Anti-RPA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026306
Antibody type
Polyclonal
Antigen
replication protein A2, 32kDa recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFM
PANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLK
HMSVSSIKQAVDFLSNEGHIYSTVDDDH
Storage
-20C
Provider Type Product Number
- No reagents -