HPA026309

RPA2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026309
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026309, RRID:AB_10601572
Product name
Anti-RPA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026309
Antibody type
Polyclonal
Antigen
replication protein A2, 32kDa recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAE
KKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEI
SQVTI
Storage
-20C
Provider Type Product Number
- No reagents -