Antibody data

Product number
H00006517-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006517-M04, RRID:AB_1137458
Product name
SLC2A4 monoclonal antibody (M04), clone 1F1
Provider product page
Abnova Corporation - H00006517-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SLC2A4.
Antigen sequence
RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELE
YLGPDEND
Isotype
IgG
Antibody clone number
1F1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -