Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 20-272-191403 - Provider product page
- Provider
- GenWay
- Product name
- RBL3 [130P215]
- Antibody type
- Monoclonal
- Antigen
- Synthetic peptide: QCPELMMDRHLDQLLMCAIYVMAKVTKEDKSFQNIM, corresponding to amino acids 878-913 of Human p130.
- Description
- Protein G purified
- Reactivity
- Human, Mouse, Rat
- Host
- Mouse
- Isotype
- IgG
- Vial size
- 0.5 ml
- Storage
- Keep as concentrated solution, aliquot and store at 4C. Do not freeze.
No comments: Submit comment
No validations: Submit validation data