20-272-191403

antibody from GenWay

Targeting: RBL2 p130, Rb2

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: 20-272-191403 - Provider product page
Provider: GenWay
Product name: RBL3 [130P215]
Antibody type: Monoclonal
Antigen: Synthetic peptide: QCPELMMDRHLDQLLMCAIYVMAKVTKEDKSFQNIM, corresponding to amino acids 878-913 of Human p130.
Description: Protein G purified
Reactivity: Human, Mouse, Rat
Host: Mouse
Isotype: IgG
Vial size: 0.5 ml
Storage: Keep as concentrated solution, aliquot and store at 4C. Do not freeze.

RBL2 protein structure - 20-272-191403 shown in red.