Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN139432 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Retinoblastoma-Like 2 (p130) (RBL2) antibody
- Antibody type
- Monoclonal
- Antigen
- Synthetic peptide: QCPELMMDRHLDQLLMCAIYVMAKVTKEDKSFQNIM, corresponding to amino acids 878-913 of Human p130.
- Reactivity
- Human
- Host
- Mouse
- Isotype
- IgG
- Vial size
- 0.5 ml
- Storage
- Store at 4C. Aliquot and store at -20C long-term.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Immunohistochemistry