HPA019703

RBL2 antibody from Sigma-Aldrich
p130, Rb2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019703
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019703, RRID:AB_1856106
Product name
Anti-RBL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019703
Antibody type
Polyclonal
Antigen
Retinoblastoma-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IAGSPLTPRRVTEVRADTGGLGRSITSPTTLYDRY
SSPPASTTRRRLFVENDSPSDGGTPGRMPPQPLVN
AVPVQNVSGETVSVTPVPGQTLVTMATATVTANNG
QTVTIPVQGIANENGGITFFPVQV
Storage
-20C
Provider Type Product Number
- No reagents -