HPA000637

PABPN1 antibody from Sigma-Aldrich
OPMD, PAB2, PABP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000637
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000637, RRID:AB_1079553
Product name
Anti-PABPN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000637
Antibody type
Polyclonal
Antigen
Polyadenylate-binding protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGC
GSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSL
ALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRAR
YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARAT
SWY
Storage
-20C
Provider Type Product Number
- No reagents -