HPA000886

FRMD7 antibody from Sigma-Aldrich
FLJ43346, NYS, NYS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000886
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000886, RRID:AB_1079269
Product name
Anti-FRMD7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000886
Antibody type
Polyclonal
Antigen
FERM domain-containing protein 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QVPRWSPIRAEERTSPHSYVEPTAMKPAERSPRNI
RMKSFQQDLQVLQEAIARTSGRSNINVGLEEEDPN
LEDAFVCNIQEQTPKRSQSQSDMKTIRFPFGSEFR
PLGPCPALSHKADLFTDMFAEQELPAVLMDQSTAE
RYVASESSDS
Storage
-20C
Provider Type Product Number
- No reagents -