ABIN630329

antibody from antibodies-online

Targeting: SLC16A1 MCT, MCT1

Western blot

Antibody data

Submit

Validation data

Product number: ABIN630329 - Provider product page
Provider: antibodies-online
Product name: anti-Solute Carrier Family 16, Member 1 (Monocarboxylic Acid Transporter 1) (SLC16A1) antibody
Antibody type: Polyclonal
Antigen: SLC16 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTIN
Description: Purified
Reactivity: Human
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

SLC16A1 protein structure - ABIN630329 shown in red.