Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184201 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Caveolin 3 (CAV3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CAV3 antibody: synthetic peptide directed towards the N terminal of human CAV3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINED
IVKVD FEDVIAEPVG- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A novel mutation in the caveolin-3 gene causing familial isolated hyperCKaemia.
Alias L, Gallano P, Moreno D, Pujol R, MartĂnez-Matos JA, Baiget M, Ferrer I, OlivĂ© M
Neuromuscular disorders : NMD 2004 May;14(5):321-4
Neuromuscular disorders : NMD 2004 May;14(5):321-4
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- WB Suggested Anti-CAV3 Antibody Titration: 0.2-1 μg/mL Positive Control: Human muscle
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Sample Type: Human placental tissue Primary Antibody Dilution: 1:50Secondary Antibody: Goat anti rabbit-HRP Secondary Antibody Dilution: 1:00,000Color/Signal Descriptions: Brown: CAV3Purple: Haemotoxylin Gene Name: CAV3 Submitted by: Dr. Hiten D. Mistry and Anna Czajka, King's College London; Lesia Kurlak, University of Nottingham