Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004751-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004751-M02, RRID:AB_566005
- Product name
- NEK2 monoclonal antibody (M02), clone 2F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NEK2.
- Antigen sequence
EQELCVRERLAEDKLARAENLLKNYSLLKERKFLS
LASNPELLNLPSSVIKKKVHFSGESKENIMRSENS
ESQLTSKSKCKDLKKRLHAAQLRAQALSDIEKNYQ
LKSRQILGMR- Isotype
- IgG
- Antibody clone number
- 2F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NEK2 monoclonal antibody (M02), clone 2F9 Western Blot analysis of NEK2 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NEK2 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to NEK2 on HeLa cell. [antibody concentration 30 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol