Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182723 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-LIM Domain Binding 2 (LDB2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LDB2 antibody: synthetic peptide directed towards the N terminal of human LDB2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
DDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEG
GVTDL YYILKHSKES- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Lhx9: a novel LIM-homeodomain gene expressed in the developing forebrain.
Rétaux S, Rogard M, Bach I, Failli V, Besson MJ
The Journal of neuroscience : the official journal of the Society for Neuroscience 1999 Jan 15;19(2):783-93
The Journal of neuroscience : the official journal of the Society for Neuroscience 1999 Jan 15;19(2):783-93
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting