HPA016699

CBX5 antibody from Sigma-Aldrich
HP1, HP1-ALPHA, HP1Hs-alpha
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016699
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016699, RRID:AB_1850627
Product name
Anti-CBX5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016699
Antibody type
Polyclonal
Antigen
Chromobox protein homolog 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELIS
EFMKKYKKMKEGENNKPREKSESNKRKSNFSNSAD
DIKSKKKREQSNDIARGFERGLEPEKIIGATDSCG
DLM
Storage
-20C
Provider Type Product Number
- No reagents -