HPA027376

PDK1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027376
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027376, RRID:AB_1855139
Product name
Anti-PDK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027376
Antibody type
Polyclonal
Antigen
No description available in Ensembl
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKD
KSAEDAKAIYDFTDTVIRIRNRHND
Storage
-20C
Provider Type Product Number
- No reagents -