Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183964 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-EIF3S9 antibody: synthetic peptide directed towards the C terminal of human EIF3S9
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus
- Host
- Rabbit
- Antigen sequence
YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDW
EEETI EFFVTEEIIP- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The j-subunit of human translation initiation factor eIF3 is required for the stable binding of eIF3 and its subcomplexes to 40 S ribosomal subunits in vitro.
Fraser CS, Lee JY, Mayeur GL, Bushell M, Doudna JA, Hershey JW
The Journal of biological chemistry 2004 Mar 5;279(10):8946-56
The Journal of biological chemistry 2004 Mar 5;279(10):8946-56
No comments: Submit comment
No validations: Submit validation data