HPA000727

SPIN3 antibody from Sigma-Aldrich
TDRD27
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000727
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000727, RRID:AB_2196121
Product name
Anti-SPIN3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000727
Antibody type
Polyclonal
Antigen
Spindlin-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KAAHKKHRSRPTSQPRGNIVGCRIQHGWKDGDEPL
TQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELHR
DERVSSLEVLPNRVASSRISDTHLAEIMVGKAVEH
IFETEEGSKNEWRGMVLAQAPVMNTW
Storage
-20C
Provider Type Product Number
- No reagents -