Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487150 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transcription Factor AP-2 beta (Activating Enhancer Binding Protein 2 Beta) (TFAP2B) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TFAP2B antibody: synthetic peptide directed towards the C terminal of human TFAP2B
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
ALTALQNYLTEALKGMDKMFLNNTTTNRHTSGEGP
GSKTG DKEEKHRK- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Electrophysiological and behavioral correlates of polymorphisms in the transcription factor AP-2beta coding gene.
Hensch T, Wargelius HL, Herold U, Strobel A, Oreland L, Brocke B
Neuroscience letters 2008 May 2;436(1):67-71
Neuroscience letters 2008 May 2;436(1):67-71
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting