HPA055873

S100G antibody from Atlas Antibodies
CABP1, CABP9K, CALB3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA055873
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA055873, RRID:AB_2682952
Product name
Anti-S100G
Provider product page
Atlas Antibodies - HPA055873
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAE
FPSLLKGPNTLDDLFQELDK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -