Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004684-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004684-M01, RRID:AB_489972
- Product name
- NCAM1 monoclonal antibody (M01), clone 3G12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NCAM1.
- Antigen sequence
EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHY
LVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEY
EVYVVAENQQGKSKAAHFVFRTSAQPTAIP- Isotype
- IgG
- Antibody clone number
- 3G12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Molecular characterization and expression analyses of ST8Sia II and IV in piglets during postnatal development: lack of correlation between transcription and posttranslational levels.
Zhu X, Chen Y, Zhang N, Zheng Z, Zhao F, Liu N, Lv C, Troy FA 2nd, Wang B
Glycoconjugate journal 2015 Dec;32(9):715-28
Glycoconjugate journal 2015 Dec;32(9):715-28
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NCAM1 expression in transfected 293T cell line by NCAM1 monoclonal antibody (M01), clone 3G12.Lane 1: NCAM1 transfected lysate(94.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NCAM1 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol