HPA000564

IL1RAPL1 antibody from Sigma-Aldrich
IL1R8, IL1RAPL, MRX10, MRX21, MRX34, OPHN4, TIGIRR-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000564
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000564, RRID:AB_1079134
Product name
Anti-IL1RAPL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000564
Antibody type
Polyclonal
Antigen
X-linked interleukin-1 receptor accessory protein-like 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSKFWKRLQYEMPFKRIEPITHEQALDVSEQGPFG
ELQTVSAISMAAATSTALATAHPDLRSTFHNTYHS
QMRQKHYYRSYEYDVPPTGTLPLTSIGNQHTYCNI
PMTLINGQRPQTKSSREQNPDEAHTNSAILPLLPR
ETSI
Storage
-20C
Provider Type Product Number
- No reagents -