HPA001818

CREM antibody from Atlas Antibodies
hCREM-2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001818
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001818, RRID:AB_1078566
Product name
Anti-CREM
Provider product page
Atlas Antibodies - HPA001818
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QHDGSITASLTESKSAHVQTQTGQNSIPALAQVAA
IAETDESAESEGVIDSHKRREILSRRPSYRKILNE
LSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIY
QTSTGQYIAIAQGGTIQISNPGSD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -