HPA001818

CREM antibody from Sigma-Aldrich
hCREM-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001818
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001818, RRID:AB_1078566
Product name
Anti-CREM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001818
Antibody type
Polyclonal
Antigen
cAMP-responsive element modulator recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QHDGSITASLTESKSAHVQTQTGQNSIPALAQVAA
IAETDESAESEGVIDSHKRREILSRRPSYRKILNE
LSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIY
QTSTGQYIAIAQGGTIQISNPGSD
Storage
-20C
Provider Type Product Number
- No reagents -