Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ARP42381_P050 - Provider product page

- Provider
- Aviva Systems Biology
- Product name
- Tmem2 antibody - N-terminal region (ARP42381_P050)
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide
- Description
- This is a rabbit polyclonal antibody against Tmem2. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Antigen sequence
MYAAGSRGHSPAFLQPQNGNGHRSPGYVPGKVVPL
RPAPPPKNHASAKLT- Vial size
- 50 µg
- Concentration
- 1 mg/ml
- Handling
- Add 50 µl of distilled water. Final anti-Tmem2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Submitted references Rare inborn errors associated with chronic hepatitis B virus infection.
Zhao Q, Peng L, Huang W, Li Q, Pei Y, Yuan P, Zheng L, Zhang Y, Deng J, Zhong C, Hu B, Ding H, Fang W, Li R, Liao Q, Lin C, Deng W, Yan H, Hou J, Wu Q, Xu T, Liu J, Hu L, Peng T, Chen S, Lai KN, Yuen MF, Wang Y, Maini MK, Li C, Li M, Wang J, Zhang X, Sham PC, Wang J, Gao ZL, Wang Y
Hepatology (Baltimore, Md.) 2012 Nov;56(5):1661-70
Hepatology (Baltimore, Md.) 2012 Nov;56(5):1661-70
No comments: Submit comment
Supportive validation
- Submitted by
- Aviva Systems Biology (provider)
- Main image

- Experimental details
- WB Suggested Anti-Tmem2 AntibodyTitration: 1.0µg/ml. Positive Control: Mouse Liver