Explore
Validate
Learn
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029834 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA029834, RRID:AB_10602821
- Product name
- Anti-PRKD1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RELECKIGERYITHESDDLRWEKYAGEQGLQYPTH
LINPSASHSDTPETEETEMKALGER- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Hotspot activating PRKD1 somatic mutations in polymorphous low-grade adenocarcinomas of the salivary glands
Weinreb I, Piscuoglio S, Martelotto L, Waggott D, Ng C, Perez-Ordonez B, Harding N, Alfaro J, Chu K, Viale A, Fusco N, da Cruz Paula A, Marchio C, Sakr R, Lim R, Thompson L, Chiosea S, Seethala R, Skalova A, Stelow E, Fonseca I, Assaad A, How C, Wang J, de Borja R, Chan-Seng-Yue M, Howlett C, Nichols A, Wen Y, Katabi N, Buchner N, Mullen L, Kislinger T, Wouters B, Liu F, Norton L, McPherson J, Rubin B, Clarke B, Weigelt B, Boutros P, Reis-Filho J
Nature Genetics 2014 September;46(11):1166-1169
Nature Genetics 2014 September;46(11):1166-1169
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human parathyroid gland shows cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
