Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184274 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-V-Ets erythroblastosis Virus E26 Oncogene Homolog (Avian) (ERG) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ERG antibody: synthetic peptide directed towards the middle region of human ERG
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
ARNTDLPYEPPRRSAWTGHGHPTPQSKAAQPSPST
VPKTE DQRPQLDPYQ- Vial size
- 0.1 mg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references COL11A2 collagen gene transcription is differentially regulated by EWS/ERG sarcoma fusion protein and wild-type ERG.
Matsui Y, Chansky HA, Barahmand-Pour F, Zielinska-Kwiatkowska A, Tsumaki N, Myoui A, Yoshikawa H, Yang L, Eyre DR
The Journal of biological chemistry 2003 Mar 28;278(13):11369-75
The Journal of biological chemistry 2003 Mar 28;278(13):11369-75
No comments: Submit comment
No validations: Submit validation data