HPA026073

REPS2 antibody from MilliporeSigma / Merck KGaA
POB1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026073
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-REPS2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026073
Antibody type
Polyclonal
Antigen
RalBP1-associated Eps domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YPLPEGLPPTLQPEYLQAAFPKPKWDCQLFDSYSE
SLPANQQPRDLNRMEKTSVKDMADLPVPNQDVTSD
DKQALKSTINEALPKDVSEDPATPKDSNSLKARPR
SRSYSSTSIEEAMKRGEDPPTPPPRPQKTHSRASS
LDLN
Storage
-20C