HPA026073

REPS2 antibody from Sigma-Aldrich
POB1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026073
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026073, RRID:AB_1856176
Product name
Anti-REPS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026073
Antibody type
Polyclonal
Antigen
RalBP1-associated Eps domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YPLPEGLPPTLQPEYLQAAFPKPKWDCQLFDSYSE
SLPANQQPRDLNRMEKTSVKDMADLPVPNQDVTSD
DKQALKSTINEALPKDVSEDPATPKDSNSLKARPR
SRSYSSTSIEEAMKRGEDPPTPPPRPQKTHSRASS
LDLN
Storage
-20C
Provider Type Product Number
- No reagents -