Antibody data

Product number
H00007029-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007029-M01, RRID:AB_1579930
Product name
TFDP2 monoclonal antibody (M01), clone 2E6
Provider product page
Abnova Corporation - H00007029-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TFDP2.
Antigen sequence
MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAE
ATGWVPGDRKRARKFIDSDFSESKRSKKGDKNGKG
LRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSN
NHLAA
Isotype
IgG
Antibody clone number
2E6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -